ATP synthase F(1) sector subunit delta atpH This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction (By similarity). PA5557 MAELTTLARPYAKAAFEYAQAHQQLADWSAALGVLAAVSQDDTVRQLLKEPQLTSSAKAQSLIDVCGDKLNAPAQNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLSKEQQDKLAKALSARLSREVRLHASEDASLIGGVIIRAGDLVIDGSVRGKLAKLAEALKS 178 F-type ATPase subunit delta ATPD_PSEAE ATP synthase subunit delta F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation (By similarity).